General Information

  • ID:  hor002913
  • Uniprot ID:  P10776
  • Protein name:  Neuroparsin-A
  • Gene name:  NA
  • Organism:  Locusta migratoria (Migratory locust)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Locusta (genus), Oedipodinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  NPISRSCEGANCVVDLTRCEYGDVTDFFGRKVCAKGPGDKCGGPYELHGKCGVGMDCRCGLCSGCSLHNLQCFFFEGGLPSSC
  • Length:  83(25-107)
  • Propeptide:  MKATAALVAATLLLAVTLFHRAERNPISRSCEGANCVVDLTRCEYGDVTDFFGRKVCAKGPGDKCGGPYELHGKCGVGMDCRCGLCSGCSLHNLQCFFFEGGLPSSC
  • Signal peptide:  MKATAALVAATLLLAVTLFHRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  inhibit the effects of juvenile hormone, stimulate fluid reabsorption of isolated recta and induces an increase in hemolymph lipid and trehalose levels
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P10776-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002913_AF2.pdbhor002913_ESM.pdb

Physical Information

Mass: 1022783 Formula: C368H569N107O116S13
Absent amino acids: W Common amino acids: G
pI: 6.43 Basic residues: 10
Polar residues: 39 Hydrophobic residues: 19
Hydrophobicity: -10.24 Boman Index: -10929
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 52.77
Instability Index: 2649.4 Extinction Coefficient cystines: 3730
Absorbance 280nm: 45.49

Literature

  • PubMed ID:  NA
  • Title:  The locust neuroparsin A: sequence and similarities with vertebrate and insect polypeptide hormones.